PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 394aa    MW: 43751.5 Da    PI: 6.3247
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017340genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Lus10017340  16 VPPGFRFHPTEEELLHYYLRKKVASDKIDL-DVIREVDLNKLEPWDIQERCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS- 111
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Lus10017340 112 GARRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5612188IPR003441NAC domain
PROSITE profilePS5100555.4816188IPR003441NAC domain
PfamPF023652.4E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MRSEHVNLSV NGQSKVPPGF RFHPTEEELL HYYLRKKVAS DKIDLDVIRE VDLNKLEPWD  60
IQERCKIGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY SGARRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDAAPT PPDTINSNSG MMVMMSDVVI GDQVGSEEGW  180
VVCRVFKKKN YQKSLDSPRL SSHVADSKPH ILTSSSSTAM ARYGTGSTGT DGVLDQILMY  240
MGRRNCKEES DYSFHLPRLV ADHEQLQLIN QSFGGGDAMV TSEDNNNNDS YGPSSGNHGS  300
NYRVDVTAGS KGGMMVVNDW AALDRLVASQ LNGHLRGDQD DVVEDEDDVD DQFRSMLKYG  360
GGGGESDNDV WTNFTKSSSS PSSSSDPLCH LSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4711903170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518924.11e-135PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-118NAC43_ARATH; NAC domain-containing protein 43
TrEMBLB9RYV51e-135B9RYV5_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0001s45250.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-108NAC family protein